DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr65Ax2

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:107 Identity:34/107 - (31%)
Similarity:48/107 - (44%) Gaps:32/107 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIVLVVCLLAVA-AADVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGS-----GVIR 60
            |.:::..|.||| ||....::..:..|....|.::              .|.|||:     ||::
  Fly     3 FAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYA--------------VETSDGTSKSEEGVLK 53

  Fly    61 ------------GAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
                        |:||||.|..|..||.|||||:||.||.:|
  Fly    54 NAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAH 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 21/68 (31%)
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 21/68 (31%)

Return to query results.
Submit another query.