DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and CG34462

DIOPT Version :9

Sequence 1:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:161 Identity:34/161 - (21%)
Similarity:60/161 - (37%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ADVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVA 79
            |.|.:....||..| :.|.|.|:.........:...|....:|.|:|::.|..|..::...:|:|
  Fly    46 AKVRNYFVHEPYGP-NTYSFGYEINDPQTQNSQFREEKRFVNGSIQGSYGYARPDGRIEVTKYMA 109

  Fly    80 DEHGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAPHASAAVAHATQKHL 144
            .|.|.:         ||.:|..|    |...::........|..:...:...|.:.:....:.||
  Fly   110 KEDGGY---------SAQIQIFK----AGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHL 161

  Fly   145 SAFERIAAEHAAIGRQQEAQRLALAAQSEHG 175
            :......|:|.       ||:|    :.:||
  Fly   162 NVTVSHVADHV-------AQQL----KQQHG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 12/51 (24%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.