DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpr57A and NOTCH1

DIOPT Version :9

Sequence 1:	NP_001137721.1	Gene:	Cpr57A / 37319	FlyBaseID:	FBgn0034517	Length:	184	Species:	Drosophila melanogaster
Sequence 2:	NP_060087.3	Gene:	NOTCH1 / 4851	HGNCID:	7881	Length:	2555	Species:	Homo sapiens

Alignment Length:	93	Identity:	19/93 - (20%)
Similarity:	36/93 - (38%)	Gaps:	13/93 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 HTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSHKLEDSAAVQAAKQ---------- 103
            |.:|:....:.:.|..:....|.| ....|..::|.:..:.:..|::....||::
Human  2018 HADVNAVDDLGKSALHWAAAVNNV-DAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLL 2081

  Fly   104 RHFAAYNRIAQEHANHTPGQVALANAPH 131
            .|||  ||...:|.:..|..:|.....|
Human  2082 DHFA--NRDITDHMDRLPRDIAQERMHH 2107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpr57A	NP_001137721.1	Chitin_bind_4	32..84	CDD:278791	6/34 (18%)
NOTCH1	NP_060087.3	EGF_CA	142..175	CDD:238011
		EGF_CA	178..216	CDD:238011
		EGF_CA	223..255	CDD:238011
		EGF_CA	257..293	CDD:238011
		EGF_CA	295..332	CDD:238011
		EGF_CA	335..370	CDD:238011
		EGF_CA	412..450	CDD:238011
		Interaction with DLL4. /evidence=ECO:0000250\|UniProtKB:Q07008	420..421
		Interaction with DLL4. /evidence=ECO:0000250\|UniProtKB:Q07008	448..452
		EGF_CA	452..488	CDD:238011
		EGF_CA	490..526	CDD:238011
		EGF_CA	528..564	CDD:238011
		EGF_CA	566..601	CDD:238011
		EGF_CA	603..639	CDD:238011
		EGF_CA	678..713	CDD:238011
		EGF_CA	717..750	CDD:238011
		EGF_CA	755..789	CDD:238011
		EGF_CA	791..827	CDD:238011
		EGF_CA	869..905	CDD:238011
		EGF_CA	907..943	CDD:238011
		EGF_CA	945..981	CDD:238011
		EGF_CA	988..1019	CDD:238011
		EGF_CA	1021..1057	CDD:238011
		EGF	1063..1093	CDD:278437
		EGF_CA	1146..1180	CDD:238011
		EGF_CA	1184..1219	CDD:238011
		EGF_CA	<1238..1265	CDD:238011
		EGF_CA	1267..1305	CDD:238011
		NL	1442..1479	CDD:197463
		LNR 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00525	1449..1489
		Notch	1487..1522	CDD:278494
		LNR 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00525	1490..1531
		Notch	1525..1561	CDD:278494
		LNR 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00525	1532..1571
		NOD	1567..1618	CDD:284282
		NODP	1672..1729	CDD:284987
		Interaction with PSEN1. /evidence=ECO:0000269\|PubMed:30598546	1728..1760
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1780..1808
		Ank_2	<1873..1958	CDD:289560
		ANK repeat	1880..1925	CDD:293786
		ANK	1922..2034	CDD:238125	3/15 (20%)
		ANK repeat	1927..1958	CDD:293786
		ANK 1. /evidence=ECO:0000255	1927..1956
		Ank_2	1932..2025	CDD:289560	2/6 (33%)
		HIF1AN-binding. /evidence=ECO:0000250	1947..1955
		ANK repeat	1960..1991	CDD:293786
		ANK 2. /evidence=ECO:0000255	1960..1990
		ANK	1989..2113	CDD:238125	19/93 (20%)
		ANK repeat	1994..2025	CDD:293786	2/6 (33%)
		ANK 3. /evidence=ECO:0000255	1994..2023		2/4 (50%)
		Ank_2	1999..2091	CDD:289560	15/75 (20%)
		HIF1AN-binding. /evidence=ECO:0000250	2014..2022		1/3 (33%)
		ANK repeat	2027..2058	CDD:293786	5/31 (16%)
		ANK 4. /evidence=ECO:0000255	2027..2056		5/29 (17%)
		ANK repeat	2060..2091	CDD:293786	8/32 (25%)
		ANK 5. /evidence=ECO:0000255	2060..2089		8/30 (27%)
		ANK 6	2095..2122		3/13 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2151..2194
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2379..2447
		Med25_SD1	<2429..2514	CDD:288132
		DUF3454	2479..2540	CDD:288764
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2483..2555
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0.924933	Normalized mean entropy	S1795
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950