DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:94 Identity:28/94 - (29%)
Similarity:49/94 - (52%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIVLVVCLLAVAAADVSHLVTPEPKVPASPYVFSY-----QAGRAPGHVDRQHTEVSDGSGVIRG 61
            |:::.|.:.|.|.|:.:.::..|..|....:.:|:     ||..|.|.:...:|:  ..|..::|
  Fly     3 FLIVFVAIFAFALANEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTD--HESLAVQG 65

  Fly    62 AFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
            :|.:|....|...|.|:|||:||.||.:|
  Fly    66 SFRFVADDGQTYEVNYIADENGFQPQGAH 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 16/56 (29%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 16/56 (29%)

Return to query results.
Submit another query.