DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr92F

DIOPT Version :9

Sequence 1:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_650905.2 Gene:Cpr92F / 42450 FlyBaseID:FBgn0038819 Length:381 Species:Drosophila melanogaster


Alignment Length:253 Identity:59/253 - (23%)
Similarity:83/253 - (32%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FIVLVVCLLAVAAADVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYV 66
            |.:....|::..:|.....|:.:.: ...|:..:|..|.|..:..:..|...||:  ..|::|||
  Fly     4 FFIAAALLISTVSASWHGAVSTQYQ-HLDPHSHTYSYGYADPNSQKHETRSHDGT--THGSYSYV 65

  Fly    67 DPKNQVRTVQYVAD-EHGFH-------------------------------------PQLSH--K 91
            |....|::|.|.|| .|||:                                     |.|:|  .
  Fly    66 DGHGHVQSVSYTADPHHGFNAVGTNLPQAPQVHAAPVYAAAHAHGAYAPYAHGPIHIPVLTHGGV 130

  Fly    92 LEDSAAVQAAKQRHFAAYNRIAQEHANH----------------------TPGQVALANAPHASA 134
            ..|:..||.||..|.||:...|.....|                      |.|.|.: :.|...|
  Fly   131 PVDTPEVQHAKAAHAAAHAAAAHNAGGHHLYKRSIYGGGWAYGQAAHVPLTHGGVPV-DTPDVQA 194

  Fly   135 AVAHATQKHLSAFERIAAEHAAIGRQQEAQRLA-------LAAQSEH--GEIEDGQYH 183
            |.|.....|..|...:|..|.|.....|.|...       .||:|.|  ..|..|.||
  Fly   195 AKAEHYAAHAKALGHVAHAHGAPVETPEVQHAKAAHFAAHAAARSGHAVSPINHGGYH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 17/52 (33%)
Cpr92FNP_650905.2 Chitin_bind_4 37..84 CDD:278791 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.