DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Ccp84Ad

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_649680.1 Gene:Ccp84Ad / 40822 FlyBaseID:FBgn0004780 Length:199 Species:Drosophila melanogaster


Alignment Length:152 Identity:44/152 - (28%)
Similarity:65/152 - (42%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAVAAADVSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVR 73
            :||.||.:..    |.|:     |.::|....:.....:...|..||. |:||.:|.:|.....|
  Fly    48 VLAKAAEEYD----PHPQ-----YKYAYDVQDSLSGDSKSQVEERDGD-VVRGEYSLIDADGYKR 102

  Fly    74 TVQYVADE-HGFHPQLSHK-LEDSAAVQ------AAKQRHFAAYNRIAQEHANHTPGQVALANAP 130
            ||||.||. :||:..::.: |..:.||.      ||...|:|     |...|::....|....||
  Fly   103 TVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAHYA-----APAVAHYAAPAVVKTVAP 162

  Fly   131 HASAAVAHATQKHLSAFERIAA 152
            .|..| |.|..|.::.....||
  Fly   163 VAHYA-APAVVKTVAPVAHYAA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 17/52 (33%)
Ccp84AdNP_649680.1 Chitin_bind_4 62..114 CDD:459790 17/52 (33%)

Return to query results.
Submit another query.