DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:97 Identity:30/97 - (30%)
Similarity:48/97 - (49%) Gaps:17/97 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVCLLA------VAAADVSH--LVTPEPKVPASP---YVFSYQAGRAPGHVDRQHTEVSDGSGV 58
            |.:||||      |.|.:::.  ::|.|...||..   |.::::....     .|..|..:.:| 
  Fly     4 LSLCLLAALMLANVYADNINKDAVITREDVNPADAEGNYQYAFETSNG-----IQAQEAGNVNG- 62

  Fly    59 IRGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
            |.|:.||:.|:....::.|||||:||.||..|
  Fly    63 ISGSSSYISPEGVPISLTYVADENGFQPQGDH 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 14/51 (27%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 14/51 (27%)

Return to query results.
Submit another query.