DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr76Bc

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:208 Identity:46/208 - (22%)
Similarity:77/208 - (37%) Gaps:69/208 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YVFSYQAGRAPGHVDRQHT-------EVSDGSGVIRGAFSYVDPKNQVRTVQYVAD-EHGFH--- 85
            |.|||       .|...||       |..||.|| :|.:|.::|...:|||.|.|| :.||:   
  Fly    56 YAFSY-------GVKDLHTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFNAIV 112

  Fly    86 -------------PQLSHKLEDSAAVQAAKQRHFAAYNRIAQEH----ANHTPGQVALANAPHAS 133
                         |:.|:::.|..:  .:|..|::.    .|||    ::..|.:..:.:..|:.
  Fly   113 KTVGANSHPITESPEGSNQVNDDTS--QSKINHYSK----DQEHIVLSSDIKPLKRPIEDLTHSH 171

  Fly   134 AAV-------AHATQKHL-----------------SAFERIAAEHAAIGRQQEAQRLALAAQSEH 174
            ..|       .||..|.:                 :.:::|||.|......|:.|......:.:.
  Fly   172 PKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDW 236

  Fly   175 GEI---EDGQYHP 184
            ..:   |..:|.|
  Fly   237 KAVIVNEPKEYRP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 21/59 (36%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 21/59 (36%)

Return to query results.
Submit another query.