DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and CG13670

DIOPT Version :9

Sequence 1:NP_001137721.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:172 Identity:39/172 - (22%)
Similarity:62/172 - (36%) Gaps:33/172 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VSHLVTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADE 81
            |.::..||       |.|:|........|.:...|..:|..| ||.:|.|||...:|.|:|.||:
  Fly    95 VDYVARPE-------YSFAYGVEDGKTRVLQNRKETRNGDEV-RGVYSVVDPDGTLRVVKYTADD 151

  Fly    82 -HGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQEHANHTPGQVALANAP----HASAAVAHATQ 141
             :||..::                   ..|.:...|.:.:.|.....:..    |.||. ||..:
  Fly   152 ANGFQAEV-------------------ITNGVKTLHGHGSDGDAGGGSVDSQVRHHSAE-AHKAK 196

  Fly   142 KHLSAFERIAAEHAAIGRQQEAQRLALAAQSEHGEIEDGQYH 183
            :.....:....||...|:.|..:........:..|.|:|..|
  Fly   197 EDDEEEDEREREHQGNGQYQVHEDYDEGKDEQAEEDEEGGGH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_001137721.1 Chitin_bind_4 32..84 CDD:278791 18/52 (35%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 18/52 (35%)
Paf1 <215..265 CDD:281915 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.