DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:96 Identity:28/96 - (29%)
Similarity:44/96 - (45%) Gaps:20/96 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLVVCLLAVAAADVSHL-------------VTPEPKVPASPYVFSYQAGRAPGHVDRQHTEVSDG 55
            :.::|...:||.:.:.|             |.|.|:     |.|:|....|.....:...||.||
  Fly     6 ITLICCALIAAIECALLPAAVPVGVPLNTEVDPHPQ-----YAFAYNVQDALTGDSKSQQEVRDG 65

  Fly    56 SGVIRGAFSYVDPKNQVRTVQYVADE-HGFH 85
            . |::|::|.||....:|||.|.||. :||:
  Fly    66 D-VVKGSYSVVDADGSLRTVFYTADPINGFN 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 19/52 (37%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 19/52 (37%)

Return to query results.
Submit another query.