DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:63 Identity:20/63 - (31%)
Similarity:30/63 - (47%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YVFSYQAGRAPGHVDRQHTEVSD--GSGVI--RGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
            |...|:.|.:..|.:....:..|  .:||:  .|.:||..|:..:..|||.|||:||.....|
  Fly    66 YKTEYETGNSIIHEETGFLKDFDTNPNGVLVQHGQYSYQSPEGTLVNVQYTADENGFRATGDH 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 17/55 (31%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.