DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:117 Identity:29/117 - (24%)
Similarity:41/117 - (35%) Gaps:37/117 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVAAADVSHLVTPEPKVPASPYVFSYQA----GRAPGH------VDRQHTEVS-DG--------S 56
            ||.....|....|.|...|.|.:....|    ||..|.      :.||..:|. ||        :
  Fly   117 AVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETEN 181

  Fly    57 GVI------------------RGAFSYVDPKNQVRTVQYVADEHGFHPQLSH 90
            |::                  :|.:.|..|...:..|.||||::||.|..:|
  Fly   182 GILGEESGRIEKLTEEEGLRSKGFYEYTGPDGILYRVDYVADDNGFVPSAAH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 18/88 (20%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 9/53 (17%)

Return to query results.
Submit another query.