DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Lcp1

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_476619.1 Gene:Lcp1 / 35817 FlyBaseID:FBgn0002531 Length:130 Species:Drosophila melanogaster


Alignment Length:97 Identity:31/97 - (31%)
Similarity:43/97 - (44%) Gaps:13/97 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIVLVVCL---LAVAAADVSHLVTPEPKVPASPYVFSYQAG-RAPGHVDRQHTE-------VSD 54
            ||..:::|.   ||||...|.|.:.....|.|.  |.|.... ||.|.....||.       ..|
  Fly     1 MFKFVMICAVLGLAVANPPVPHSLGRSEDVHAD--VLSQSDDVRADGFDSSLHTSNGIEQAASGD 63

  Fly    55 GSGVIRGAFSYVDPKNQVRTVQYVADEHGFHP 86
            ..|.|.|.|.::.|:.:...|:|||:|:|:.|
  Fly    64 AHGNIHGNFGWISPEGEHVEVKYVANENGYQP 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 18/59 (31%)
Lcp1NP_476619.1 Chitin_bind_4 46..93 CDD:459790 13/46 (28%)

Return to query results.
Submit another query.