DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and Pcp

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:106 Identity:28/106 - (26%)
Similarity:43/106 - (40%) Gaps:30/106 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GSGVIRGAFSYVDPKNQVRTVQYVADEHGFHPQLSH--------------------KLEDSAAVQ 99
            |...::|..||..|:.:|.:|.|||||.|:||..:|                    :::|....:
  Fly    63 GGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQVPDYILRSLEYIRTHPYQIKDYYTGE 127

  Fly   100 AAKQRHFAA----YNRIAQEHA------NHTPGQVALANAP 130
            .....|.||    |.|..|:|.      :.||..:.|.:.|
  Fly   128 LKTVEHDAAAFNVYTRNIQDHTIPQSRPSTTPKTIYLTHPP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 12/28 (43%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790 12/28 (43%)

Return to query results.
Submit another query.