DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr57A and LOC3290255

DIOPT Version :10

Sequence 1:NP_611489.1 Gene:Cpr57A / 37319 FlyBaseID:FBgn0034517 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_565333.2 Gene:LOC3290255 / 3290255 VectorBaseID:AGAMI1_006467 Length:182 Species:Anopheles gambiae


Alignment Length:99 Identity:23/99 - (23%)
Similarity:40/99 - (40%) Gaps:16/99 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PASPYVFSYQAGRAPGHVDRQHTEVSDGSGVIRGAFSYVDPKNQVRTVQYVADE----------- 81
            |...|.:..|......|  :...|:.||. |::|.::..|.....|.|:|.:|:           
Mosquito    86 PKYKYDYGVQDAHTGDH--KSQWEIRDGD-VVKGGYTLYDADGTKRVVEYSSDKHHGFQAHVKRV 147

  Fly    82 -HGFHPQLSHKLEDSAAVQAAKQRHFAAYNRIAQ 114
             |.:|||: :|.|...:.....:....:|:.|.|
Mosquito   148 GHAYHPQV-YKTEHGISGGGYDEAEGYSYSNINQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr57ANP_611489.1 Chitin_bind_4 32..84 CDD:459790 14/63 (22%)
LOC3290255XP_565333.2 Chitin_bind_4 88..140 CDD:459790 13/54 (24%)

Return to query results.
Submit another query.