DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and CRR1

DIOPT Version :9

Sequence 1:NP_001286634.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_013314.1 Gene:CRR1 / 850910 SGDID:S000004203 Length:422 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:22/114 - (19%)
Similarity:36/114 - (31%) Gaps:53/114 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YEAPEAQVRV---FYPRGFEVSIPDAEGISLFAFHGKLN---------EEFDGLEAGQWSRDIP- 72
            |..|:..:|:   .:|.|.|.:.|           |.:|         ...|.:|.||::..:. 
Yeast   295 YRYPQTPMRLEIAVWPGGSETNGP-----------GTINWAGGLIDWENSPDIIEKGQFTAHVEQ 348

  Fly    73 ------------------KAKRGRWTFR-----------DHKTKLNHGD 92
                              |||:...||.           :.:.:|||.|
Yeast   349 ITVTPYQNKFTEQVQFCIKAKKKAPTFSQKDLSRVVVSYNRQDRLNHHD 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_001286634.1 CBM39 24..124 CDD:292510 21/111 (19%)
CRR1NP_013314.1 ChtBD1_GH16 29..75 CDD:211314
GH16_fungal_CRH1_transglycosylase 143..354 CDD:185692 13/69 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.