DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and XTH28

DIOPT Version :9

Sequence 1:NP_001286634.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_172925.1 Gene:XTH28 / 838037 AraportID:AT1G14720 Length:332 Species:Arabidopsis thaliana


Alignment Length:50 Identity:9/50 - (18%)
Similarity:21/50 - (42%) Gaps:1/50 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 HAYEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDG-LEAGQW 67
            |.:.:...::...|..|..::...:.|......|.:::.||.| :...:|
plant    73 HGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREW 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_001286634.1 CBM39 24..124 CDD:292510 7/44 (16%)
XTH28NP_172925.1 GH16_XET 29..290 CDD:185685 8/49 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.