powered by:
Protein Alignment CG30148 and XTH28
DIOPT Version :9
Sequence 1: | NP_001286634.1 |
Gene: | CG30148 / 37318 |
FlyBaseID: | FBgn0050148 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_172925.1 |
Gene: | XTH28 / 838037 |
AraportID: | AT1G14720 |
Length: | 332 |
Species: | Arabidopsis thaliana |
Alignment Length: | 50 |
Identity: | 9/50 - (18%) |
Similarity: | 21/50 - (42%) |
Gaps: | 1/50 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 HAYEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDG-LEAGQW 67
|.:.:...::...|..|..::...:.|......|.:::.||.| :...:|
plant 73 HGFFSSSIKLPADYSAGVVIAFYLSNGDLYEKNHDEIDFEFLGNIRGREW 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.