powered by:
Protein Alignment CG30148 and XTH29
DIOPT Version :9
Sequence 1: | NP_001286634.1 |
Gene: | CG30148 / 37318 |
FlyBaseID: | FBgn0050148 |
Length: | 124 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_193634.1 |
Gene: | XTH29 / 827635 |
AraportID: | AT4G18990 |
Length: | 357 |
Species: | Arabidopsis thaliana |
Alignment Length: | 49 |
Identity: | 16/49 - (32%) |
Similarity: | 20/49 - (40%) |
Gaps: | 12/49 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 AYEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDG-LEAGQW 67
||.| ..|..||....:|.:.| |.:|:.||.| ||...|
plant 94 AYTA--GIVVAFYTSNGDVFVKD---------HDELDIEFLGNLEGKPW 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30148 | NP_001286634.1 |
CBM39 |
24..124 |
CDD:292510 |
13/45 (29%) |
XTH29 | NP_193634.1 |
LamG |
40..312 |
CDD:304605 |
16/49 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.