DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and XTH15

DIOPT Version :10

Sequence 1:NP_665889.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_193149.2 Gene:XTH15 / 827051 AraportID:AT4G14130 Length:289 Species:Arabidopsis thaliana


Alignment Length:93 Identity:17/93 - (18%)
Similarity:32/93 - (34%) Gaps:37/93 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ISLF--AFHGKLNEEFDGLEAGQWSRDIPKAKRGRWTFRDHKTKLNHGDTLYFWTYVIYNGLGYR 108
            ::||  |:.....:|||                  .|:.||:.|:.:|..:...:....:|.|::
plant    17 VTLFGSAYASNFFDEFD------------------LTWGDHRGKIFNGGNMLSLSLDQVSGSGFK 63

  Fly   109 QDE-----------------GAHVVTSY 119
            ..:                 .|..||:|
plant    64 SKKEYLFGRIDMQLKLVAGNSAGTVTAY 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_665889.1 CBM39 24..124 CDD:464924 17/93 (18%)
XTH15NP_193149.2 GH16_XET 23..284 CDD:185685 15/87 (17%)

Return to query results.
Submit another query.