DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and XTH3

DIOPT Version :10

Sequence 1:NP_665889.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_189141.1 Gene:XTH3 / 822096 AraportID:AT3G25050 Length:290 Species:Arabidopsis thaliana


Alignment Length:38 Identity:10/38 - (26%)
Similarity:15/38 - (39%) Gaps:14/38 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LEAGQWSRDIPKAKRGRWTFRDHKTKLNHGDTLYFWTY 99
            :||..|:.|       .|.....:||:|       |:|
plant   190 VEASLWNGD-------DWATDGGRTKVN-------WSY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_665889.1 CBM39 24..124 CDD:464924 10/38 (26%)
XTH3NP_189141.1 GH16_XET 33..289 CDD:185685 10/38 (26%)

Return to query results.
Submit another query.