DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and XTH16

DIOPT Version :10

Sequence 1:NP_665889.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_566738.1 Gene:XTH16 / 821955 AraportID:AT3G23730 Length:291 Species:Arabidopsis thaliana


Alignment Length:193 Identity:43/193 - (22%)
Similarity:62/193 - (32%) Gaps:63/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LPLQDVYKI--GGIGTVPVGRVETGVLKPGMVVVFAPVNITTEVKSVEMHHEALAEALP--GDNV 308
            |||..:...  ..|..|.:....||.....:.:|  |..:||      .:|......:|  .|..
plant   377 LPLATIVMCFSSSITIVTISAAMTGFTFSVLQIV--PYTLTT------FYHHNRQVYVPKYKDAG 433

  Fly   309 GFNVKNVSVKELRRGYVAGDSKASPPKGASDFTAQVIVLNHPGQICNGYTPVLDCHTAHIACKFA 373
            |:|  ||:.||.:.|:     ....|.|.|.|.:                               
plant   434 GYN--NVTEKERKTGF-----HKDTPNGVSIFPS------------------------------- 460

  Fly   374 EIKEKCDRRSGKVTEENPKSIKSG---DAAIVNLVPSKPLCVESFQEFPPLGRFAVRDMRQTV 433
             :..:||.   .||..:|.:.|.|   |.||::      ..|...|..|.|....:..|.|||
plant   461 -LGPECDT---TVTITDPSAQKHGICLDMAILD------SAVLLSQVVPSLVMGFIVQMTQTV 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_665889.1 CBM39 24..124 CDD:464924
XTH16NP_566738.1 GH16_XET 24..286 CDD:185685
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.