DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and GNBP2

DIOPT Version :10

Sequence 1:NP_665889.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_524141.1 Gene:GNBP2 / 40033 FlyBaseID:FBgn0040322 Length:461 Species:Drosophila melanogaster


Alignment Length:116 Identity:31/116 - (26%)
Similarity:49/116 - (42%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPLCLLLLVLAIAFGHAYEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDGLEAGQWS 68
            ||..|||:.....||  ::.|.....:....||||||||..||....:..::::....|      
  Fly     6 LPCLLLLISNNKIFG--FKVPSINFEMLKDEGFEVSIPDEPGIQRVFYMFQIDDTCPAL------ 62

  Fly    69 RD-IPKAKRGRWTFRDHKTKLNHGDTLYFWTYVIYNGLGYRQDEGAHVVTS 118
            .| |.:|..|.|..: .|..|.:.|.|.....|.:|...:.:.|...::.:
  Fly    63 MDYITEAVNGSWVSK-QKMSLQNNDKLQISMLVQFNEEIFEKSETRVIINT 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_665889.1 CBM39 24..124 CDD:464924 24/96 (25%)
GNBP2NP_524141.1 CBM39 22..120 CDD:464924 24/98 (24%)
GH16_beta_GRP 165..460 CDD:185688
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.