DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and GNBP2

DIOPT Version :9

Sequence 1:NP_001286634.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_524141.1 Gene:GNBP2 / 40033 FlyBaseID:FBgn0040322 Length:461 Species:Drosophila melanogaster


Alignment Length:116 Identity:31/116 - (26%)
Similarity:49/116 - (42%) Gaps:10/116 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LPLCLLLLVLAIAFGHAYEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDGLEAGQWS 68
            ||..|||:.....||  ::.|.....:....||||||||..||....:..::::....|      
  Fly     6 LPCLLLLISNNKIFG--FKVPSINFEMLKDEGFEVSIPDEPGIQRVFYMFQIDDTCPAL------ 62

  Fly    69 RD-IPKAKRGRWTFRDHKTKLNHGDTLYFWTYVIYNGLGYRQDEGAHVVTS 118
            .| |.:|..|.|..: .|..|.:.|.|.....|.:|...:.:.|...::.:
  Fly    63 MDYITEAVNGSWVSK-QKMSLQNNDKLQISMLVQFNEEIFEKSETRVIINT 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_001286634.1 CBM39 24..124 CDD:292510 24/96 (25%)
GNBP2NP_524141.1 CBM39 22..120 CDD:292510 24/98 (24%)
GH16_beta_GRP 165..460 CDD:185688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464985
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.