DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30148 and CG12780

DIOPT Version :9

Sequence 1:NP_001286634.1 Gene:CG30148 / 37318 FlyBaseID:FBgn0050148 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster


Alignment Length:95 Identity:47/95 - (49%)
Similarity:57/95 - (60%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YEAPEAQVRVFYPRGFEVSIPDAEGISLFAFHGKLNEEFDGLEAGQWSRD-IPKAKRGRWTFRDH 84
            |:.|.|:|.....|||||||.|..|||||.|||:|||....|....|:.| |.|.|.||||:.:.
  Fly     4 YQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYTNR 68

  Fly    85 KTKLNHGDTLYFWTYVIYNGLGY-RQDEGA 113
            ..:|..||.||:||.|.|||..| |.::.|
  Fly    69 DVELKDGDVLYYWTTVRYNGRDYHRMNQSA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30148NP_001286634.1 CBM39 24..124 CDD:292510 46/92 (50%)
CG12780NP_610388.1 CBM39 6..97 CDD:292510 45/90 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452118
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.