DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP-like3 and SKN1

DIOPT Version :9

Sequence 1:NP_611483.1 Gene:GNBP-like3 / 37313 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_011659.3 Gene:SKN1 / 853045 SGDID:S000003375 Length:771 Species:Saccharomyces cerevisiae


Alignment Length:146 Identity:34/146 - (23%)
Similarity:45/146 - (30%) Gaps:61/146 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYLFLV------------------AISVGSSLSYDVPKATVKVNSPKGFEVSI----PDEPGIS- 50
            |::|:|                  |.|.|||.|....|:..:...|:...:..    ||.|..: 
Yeast   304 IFIFIVLPAITFSGVVYHHEHVHAANSAGSSSSNTTSKSLTEYQYPQLAAIRTTLVDPDTPDSAK 368

  Fly    51 ----------LFAFHGKVNEE---MDDLSDQTWAA----------------DVVSSRNGRWTYRN 86
                      ...|..:.|.|   ..|..||.|.|                |.|::.||..|.|.
Yeast   369 TRVAKDGSKWQLVFSDEFNAEGRTFYDGDDQFWTAPDIHYDATKDLEWYSPDAVTTTNGTLTLRM 433

  Fly    87 ---RNHQLRPGDVLYY 99
               |||.      |||
Yeast   434 DAFRNHD------LYY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 25/111 (23%)
SKN1NP_011659.3 SKN1 249..763 CDD:397841 34/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.