DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP-like3 and XTH12

DIOPT Version :9

Sequence 1:NP_611483.1 Gene:GNBP-like3 / 37313 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_200561.1 Gene:XTH12 / 835857 AraportID:AT5G57530 Length:285 Species:Arabidopsis thaliana


Alignment Length:182 Identity:37/182 - (20%)
Similarity:62/182 - (34%) Gaps:66/182 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTIYLFLVAISVGSSL-SYDVP---------------KATVKVNSPKGFEVS------------- 42
            |...|.|:.::.||.. |:|:.               ..|:...|..||:..             
plant    13 LASLLILIGVATGSFYDSFDITWGAGRANIFESGQLLTCTLDKTSGSGFQSKKEYLFGKIDMKIK 77

  Fly    43 -IPDEPGISLFAFH----GKVNEEMD-----DLSDQTWA--ADVVSSRNGRWTYRNRNHQLRPGD 95
             :|.....::.|::    |:..:|:|     :::.|.:.  .:|.:...|     ||..|     
plant    78 LVPGNSAGTVTAYYLSSKGETWDEIDFEFLGNVTGQPYVIHTNVFTGGKG-----NREMQ----- 132

  Fly    96 VLYYW--TTARYHGVDYHNY----NQRYVVGQGDSQRIDV---NGSNGGRQP 138
             .|.|  .||     |:|.|    |...::...|...|.|   |.:||...|
plant   133 -FYLWFDPTA-----DFHTYTVLWNPLNIIFLVDGIPIRVFKNNEANGVAYP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 23/140 (16%)
XTH12NP_200561.1 GH16_XET 23..282 CDD:185685 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.