powered by:
Protein Alignment GNBP-like3 and XTH24
DIOPT Version :9
Sequence 1: | NP_611483.1 |
Gene: | GNBP-like3 / 37313 |
FlyBaseID: | FBgn0034511 |
Length: | 152 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_194756.1 |
Gene: | XTH24 / 829150 |
AraportID: | AT4G30270 |
Length: | 269 |
Species: | Arabidopsis thaliana |
Alignment Length: | 74 |
Identity: | 16/74 - (21%) |
Similarity: | 24/74 - (32%) |
Gaps: | 23/74 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 WAADVVSSRNG----RW-------TYRNRNHQLRPGDVLY------------YWTTARYHGVDYH 111
|.||..::|.| .| :|||.....:|....| .|....|...:|.
plant 187 WNADDWATRGGLVKTDWSKAPFMASYRNIKIDSKPNSNWYTQEMDSTSQARLKWVQKNYMIYNYC 251
Fly 112 NYNQRYVVG 120
..::|:..|
plant 252 TDHRRFPQG 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.