DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GNBP-like3 and GNBP1

DIOPT Version :9

Sequence 1:NP_611483.1 Gene:GNBP-like3 / 37313 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster


Alignment Length:104 Identity:34/104 - (32%)
Similarity:54/104 - (51%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVAISVGSSLSYDVPKATVKVNSPKGFEVSIPDEPGISLFAFHGKVNEEMDD-LSDQTWAADVVS 76
            |:.|..|.:.:|.:|..||:: ...||.||||||.|:.:.||:...|..... :::..:...:..
  Fly     9 LLLIGFGCTTAYKIPTPTVEL-LETGFSVSIPDEEGVKVVAFNVNRNRNFTSFINEGQYNVRLTE 72

  Fly    77 SRNGRWTYRNRNHQLRPGDVLYYWTTARYHGVDYHNYNQ 115
            .:|||||....:..||..||||.||:.::....|.:..|
  Fly    73 PQNGRWTTNFSSVPLRSQDVLYLWTSVQHQKAVYQDLAQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 30/91 (33%)
GNBP1NP_524142.2 CBM39 21..126 CDD:292510 30/92 (33%)
GH16_beta_GRP 175..491 CDD:185688
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464990
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.