DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13426 and AT5G50460

DIOPT Version :10

Sequence 1:NP_611482.1 Gene:CG13426 / 37312 FlyBaseID:FBgn0034510 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_568728.1 Gene:AT5G50460 / 835114 AraportID:AT5G50460 Length:69 Species:Arabidopsis thaliana


Alignment Length:57 Identity:30/57 - (52%)
Similarity:44/57 - (77%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIVNIIM 104
            |.:||.|:|:|..|||.||||:||.::::...:||::||.:||.|||:.|||.|||:
plant    10 PLRDFAKDSIRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIV 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13426NP_611482.1 secE <50..104 CDD:469787 28/53 (53%)
AT5G50460NP_568728.1 secE <7..68 CDD:469787 30/57 (53%)

Return to query results.
Submit another query.