DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13426 and CG8860

DIOPT Version :9

Sequence 1:NP_611482.1 Gene:CG13426 / 37312 FlyBaseID:FBgn0034510 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_610738.1 Gene:CG8860 / 36310 FlyBaseID:FBgn0033691 Length:68 Species:Drosophila melanogaster


Alignment Length:57 Identity:37/57 - (64%)
Similarity:45/57 - (78%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIVNIIM 104
            |.:.|.|:|:|..||||||||:|||:|:|...|||.|||.|||.|||:||||.|||:
  Fly    10 PGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNIIV 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13426NP_611482.1 SecE <50..104 CDD:294328 35/53 (66%)
CG8860NP_610738.1 SecE <12..68 CDD:412402 36/55 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456402
Domainoid 1 1.000 70 1.000 Domainoid score I2655
eggNOG 1 0.900 - - E1_COG2443
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1911
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623399at2759
OrthoFinder 1 1.000 - - FOG0001695
OrthoInspector 1 1.000 - - otm46826
orthoMCL 1 0.900 - - OOG6_101625
Panther 1 1.100 - - P PTHR12309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1245
1110.800

Return to query results.
Submit another query.