powered by:
Protein Alignment CG13426 and CG8860
DIOPT Version :9
Sequence 1: | NP_611482.1 |
Gene: | CG13426 / 37312 |
FlyBaseID: | FBgn0034510 |
Length: | 105 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610738.1 |
Gene: | CG8860 / 36310 |
FlyBaseID: | FBgn0033691 |
Length: | 68 |
Species: | Drosophila melanogaster |
Alignment Length: | 57 |
Identity: | 37/57 - (64%) |
Similarity: | 45/57 - (78%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 PSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIVNIIM 104
|.:.|.|:|:|..||||||||:|||:|:|...|||.|||.|||.|||:||||.|||:
Fly 10 PGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFIGFFVKLIHIPINNIIV 66
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13426 | NP_611482.1 |
SecE |
<50..104 |
CDD:294328 |
35/53 (66%) |
CG8860 | NP_610738.1 |
SecE |
<12..68 |
CDD:412402 |
36/55 (65%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45456402 |
Domainoid |
1 |
1.000 |
70 |
1.000 |
Domainoid score |
I2655 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2443 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
72 |
1.000 |
Inparanoid score |
I1911 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1623399at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001695 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm46826 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101625 |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12309 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1245 |
|
11 | 10.800 |
|
Return to query results.
Submit another query.