powered by:
Protein Alignment birc5a and Bruce
DIOPT Version :9
Sequence 1: | NP_919378.1 |
Gene: | birc5a / 373110 |
ZFINID: | ZDB-GENE-030826-1 |
Length: | 142 |
Species: | Danio rerio |
Sequence 2: | NP_001262460.1 |
Gene: | Bruce / 41260 |
FlyBaseID: | FBgn0266717 |
Length: | 4976 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 32/70 - (45%) |
Similarity: | 39/70 - (55%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Zfish 17 RLQTFVGWPFEEGCVCTPENMAKAGFIHTPSENSPDIAQCFFCLKELEGWEPEDDPEKEHKAHSP 81
|.|||..||..:.....|:.||:|||.|.||.:..|.|.||.|...|..||..|:|..||:.|||
Fly 251 RRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSP 315
Zfish 82 SCDFI 86
.|.|:
Fly 316 LCPFV 320
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1404665at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.