DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp83ef

DIOPT Version :10

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:135 Identity:28/135 - (20%)
Similarity:65/135 - (48%) Gaps:24/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLWLICILTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQEL--IDRNSSEEDDLENTDRR 63
            ::.|:|||...::.:|..:.:|       ..||...:..::...:|  ::|.||.      |...
  Fly     8 LVSLFLICSQALADLSGDAQTL-------EKCLRQLSSPESIAGDLRKLERYSSW------TREE 59

  Fly    64 YKCFIHCLAEKGNLLDTNGYLDVDKID-QIEPVSDELREILYD-CK-KIYDEEEDHCEYAFKMVT 125
            ..|.:.|||.:      .|:.||::.. :::.::::|...:|: |: ::.....|.|.:|::.:.
  Fly    60 VPCLMRCLARE------KGWFDVEENKWRLKQLTEDLGADVYNYCRFELRRMGSDGCSFAYRGLR 118

  Fly   126 CLTES 130
            ||.::
  Fly   119 CLKQA 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 22/108 (20%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 23/115 (20%)
PhBP 133..234 CDD:214783
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.