DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp83a

DIOPT Version :10

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:46/97 - (47%) Gaps:11/97 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCLAEKGNLLDTNGYLDVDKIDQIEPVS 96
            |:....:::|..:|..|....|       |.:.||:::|...:..::|.||.:.::|:....|:|
  Fly    75 CVEKTGVTEAAIKEFSDGEIHE-------DEKLKCYMNCFFHEIEVVDDNGDVHLEKLFATVPLS 132

  Fly    97 --DELREILYDCKKIYDEEEDHCEYAFKMVTC 126
              |:|.|:...|  ::.|.:..|..|:....|
  Fly   133 MRDKLMEMSKGC--VHPEGDTLCHKAWWFHQC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 23/97 (24%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 23/97 (24%)

Return to query results.
Submit another query.