DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp56d

DIOPT Version :9

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001286619.1 Gene:Obp56d / 37266 FlyBaseID:FBgn0034470 Length:131 Species:Drosophila melanogaster


Alignment Length:130 Identity:31/130 - (23%)
Similarity:59/130 - (45%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLICILTVSVVSIQSLSLLEETNYVSD-----CLASNNISQAEFQELIDRNSSEEDDLENTDRRY 64
            :||.:..:..:|...|.|.:|...|:.     |.....|::.  |.:..||.:.:|    :|.:.
  Fly     3 FLIVLSVILAISAAELQLSDEQKAVAHANGALCAQQEGITKD--QAIALRNGNFDD----SDPKV 61

  Fly    65 KCFIHCLAEKGNLLDTNGYLDVDKI-DQIEPVS--DELREILYDCKKIYDEEEDHCEYAFKMVTC 126
            |||.:|..||...| .||.:..|.: .::.|::  |.::.:...|..  .:..|.|:.|:::..|
  Fly    62 KCFANCFLEKIGFL-INGEVQPDVVLAKLGPLAGEDAVKAVQAKCDA--TKGADKCDTAYQLFEC 123

  Fly   127  126
              Fly   124  123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 25/107 (23%)
Obp56dNP_001286619.1 PBP_GOBP 19..127 CDD:279703 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.