DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp47a

DIOPT Version :9

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:154 Identity:33/154 - (21%)
Similarity:61/154 - (39%) Gaps:36/154 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LTVSVVSIQSLSLLEETNYVSDCLASNNISQAEFQELIDRNSSEEDDLENTDRRYKCFIHCLAEK 74
            |||:..|.::::  ||  .:..|....:||..|..:|      :.:|..:.....:||.|||.|:
  Fly    30 LTVADESPKTIT--EE--MIRLCGDQTDISLRELNKL------QREDFSDPSESVQCFTHCLYEQ 84

  Fly    75 GNLLDTNGYLDVDKIDQIEPVSDELREILYDCKKIYDEEEDH-------CEYAFKMVTCLTESFE 132
            ..|:....:::.|....:..||:         ...:.|.:.|       ||.|:::..|..:..:
  Fly    85 MGLMHDGVFVERDLFGLLSDVSN---------TDYWPERQCHAIRGNNKCETAYRIHQCQQQLKQ 140

  Fly   133 QSDEV----------TEAGKNTNK 146
            |...:          |.||.:..|
  Fly   141 QQQNLLATKEVEVTTTPAGSDETK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 22/109 (20%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 21/98 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.