DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp57c and Obp19c

DIOPT Version :9

Sequence 1:NP_611481.1 Gene:Obp57c / 37311 FlyBaseID:FBgn0034509 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_608392.1 Gene:Obp19c / 33039 FlyBaseID:FBgn0031111 Length:175 Species:Drosophila melanogaster


Alignment Length:125 Identity:22/125 - (17%)
Similarity:47/125 - (37%) Gaps:39/125 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 LIDRNSSEEDDL------------------------ENTDRRYKCFIHCLAEKGNLLDTNGYLDV 86
            :||||..:..:|                        .|...:.||.:.|:.:|..|:|.:..|:|
  Fly    50 VIDRNLPQVQELVTAARMECIQKLQLPRDQRPLGKVTNPSEKEKCLVECVLKKIKLMDADNKLNV 114

  Fly    87 DKIDQIE-----------PVSDELREILYDCKKIYDEEEDHCEYAFKMVTCLTESFEQSD 135
            .:::::.           .||..:.:.   |.:.. ..::.||.|.....|::...|:::
  Fly   115 GQVEKLTSLVTQDNKMAIAVSSSMAQA---CSRGI-SSKNPCEVAHLFNQCISRQLERNN 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp57cNP_611481.1 PhBP 28..131 CDD:214783 21/119 (18%)
Obp19cNP_608392.1 PhBP 65..164 CDD:214783 16/102 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.