DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment xiap and Bruce

DIOPT Version :9

Sequence 1:NP_919377.2 Gene:xiap / 373108 ZFINID:ZDB-GENE-030825-7 Length:405 Species:Danio rerio
Sequence 2:NP_001262460.1 Gene:Bruce / 41260 FlyBaseID:FBgn0266717 Length:4976 Species:Drosophila melanogaster


Alignment Length:374 Identity:79/374 - (21%)
Similarity:117/374 - (31%) Gaps:115/374 - (30%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 ELESDNVAADWSV---MKNRVNSFQRFPYSEDISAQRLARAGFYFTGEGDRVQCFSCSATVQNWN 70
            ||||:.:.....:   :..::|           .||..|:.|.                ..|.||
  Fly   142 ELESEGLECPCDISNELTQKIN-----------QAQLKAKKGI----------------KAQRWN 179

Zfish    71 R--GDTP-----------------LERH----QLASP-DCRFLSCAHGMRNSNSIQSPDYDEEAE 111
            .  .:.|                 ||||    .:||. :.|......|.|      .||:.....
  Fly   180 TICLEVPYSSLKLVSNNMVILLKRLERHIPVLAIASAINERLTDMMMGSR------VPDFGWNFS 238

Zfish   112 NREFLLRTGEVVDESMYPVVPHMKSEEARLSTFNNWP-ADSP-VRPEDLAEAGMYY---IGIDDN 171
            |.:.:|                |.||..|..||..|| .|.. ..|:.:|:||.|:   ...:|.
  Fly   239 NFQRVL----------------MHSEAVRRQTFEKWPHMDYKWALPDQMAQAGFYHQPSSSGEDR 287

Zfish   172 VQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPLTTPRPRVNVHPTDTFEGRLDSF 236
            ..||.|...|..||:.|:|||||.::...|.|..|....||||                    |.
  Fly   288 AMCFTCSVCLVCWEKTDEPWSEHERHSPLCPFVKGEYTQNVPL--------------------SI 332

Zfish   237 KGRQHPIDPERLARAGFYSTGEQDRVMCFRCG--GGVKAWMPDEDPWEEHARHYPGCSFLLAEKG 299
            ....:|..|.........|..:...|:|..|.  |.:..|..:......|..|.|.....:.|:.
  Fly   333 TYATNPALPAPGLGFDIISNSDYANVLCTSCSQTGELSVWSIERHLKLMHTFHVPTLLNYIFEES 397

Zfish   300 EEYV------------SSVQLRYPKRPTQNGFSSHESGSSAQALIHGSS 336
            .|:.            :..::.|.......|.|...:|:...:.::..|
  Fly   398 FEWARVTAICVLPNARARTKVNYVYSAANYGGSGSSNGAGCNSGLNAVS 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
xiapNP_919377.2 BIR 23..89 CDD:237989 16/89 (18%)
BIR 138..206 CDD:237989 26/72 (36%)
BIR 230..296 CDD:237989 12/67 (18%)
zf-C3HC4_3 354..398 CDD:290631
BruceNP_001262460.1 BIR 251..321 CDD:279047 26/69 (38%)
DUF3643 3539..3664 CDD:289152
UQ_con 4636..4790 CDD:278603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.