DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and nectin1b

DIOPT Version :10

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:XP_073785262.1 Gene:nectin1b / 557665 ZFINID:ZDB-GENE-090224-2 Length:594 Species:Danio rerio


Alignment Length:365 Identity:93/365 - (25%)
Similarity:138/365 - (37%) Gaps:80/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSTTMTRNIEEENALLLLLAGPPVLSE-SIMGTVG---RLPC---NVTPPIYEDRVALVIWYK-- 90
            ::.::.:.:|..|       |..|.:: |..|.||   .|.|   |..||:   :::.|.|.|  
Zfish    50 NNNSLLKGLEAGN-------GQSVQTDPSKSGFVGDTVELKCLFINGKPPV---KISQVTWQKLI 104

  Fly    91 ------VGLKTPIYSVDTRDSNFAQGTHWSDETYRERLSFHVEGRAGTLTIKSTTEDDTGEYRCR 149
                  |.:..|...|... :.|.....:.....|:|....:|..  |:...|....|...|.|.
Zfish   105 NGTKQNVAIANPALGVSVL-TPFKDRVSFKHPAVRQRTPSSLEDT--TIVFSSLRLSDEAAYICE 166

  Fly   150 VDFQKSPTRNSKVNLTVIIPPESVIILDSKGVTIEDHTLGPYNEGSGINITCVAIGGRPQPRVTW 214
            .....:..|.:.|||||...|.:.:.|.|.  ||...|  |..:..  ..||::..|:|...:.|
Zfish   167 YTTFPAGNRENMVNLTVFARPVTKMTLTSP--TIVART--PKRKMP--VATCMSANGKPPSVIKW 225

  Fly   215 LHGNTVYKNASVGQPLSERRVGNTLSLAR----LERRNLHMQ-LTC----RAENNNLTTPIISSV 270
               :|..|..:..|  ..|....|:::..    |..|..|.| |||    |:|.      ...||
Zfish   226 ---DTTLKGEATFQ--ETRNPNGTVTVRSNYIVLPSRETHRQKLTCIVTYRSER------FTDSV 279

  Fly   271 VLDMNLRPLIVKLQGENRALSAGNSY------QLSCVVIGARPAPTITWWK---GSTPMKNTHEI 326
            :|::...| .||::|.:     ||.|      ||:|.. .|.|..|:..||   ||.|  |..||
Zfish   280 ILNVQYEP-EVKIEGFD-----GNWYLNRPNVQLTCNA-DANPPVTVYQWKLLNGSLP--NNIEI 335

  Fly   327 ATPDGNLTTSVLTFT-PTIDDRGKFLSCRAEQSMIPESGM 365
                   ..:.|.|. |...:.|....|.|..|:...||:
Zfish   336 -------KNNTLFFKGPVTYELGGTYVCEATNSIGTRSGL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653 28/120 (23%)
Ig strand B 69..72 CDD:409353 1/2 (50%)
Ig strand C 85..89 CDD:409353 1/3 (33%)
Ig strand E 131..135 CDD:409353 1/3 (33%)
Ig strand F 145..150 CDD:409353 2/4 (50%)
Ig 189..273 CDD:472250 22/92 (24%)
Ig strand B 197..201 CDD:409353 0/3 (0%)
Ig strand C 211..215 CDD:409353 0/3 (0%)
Ig strand E 237..241 CDD:409353 1/3 (33%)
Ig strand F 252..257 CDD:409353 4/9 (44%)
Ig strand G 267..270 CDD:409353 0/2 (0%)
Ig 290..373 CDD:472250 26/86 (30%)
Ig strand B 296..300 CDD:409353 3/9 (33%)
Ig strand C 310..314 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 366..369 CDD:409353 93/365 (25%)
Ig_3 377..456 CDD:464046
nectin1bXP_073785262.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.