DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and CG31773

DIOPT Version :9

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_722953.1 Gene:CG31773 / 326159 FlyBaseID:FBgn0051773 Length:758 Species:Drosophila melanogaster


Alignment Length:503 Identity:94/503 - (18%)
Similarity:153/503 - (30%) Gaps:167/503 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 KSPTRNSKVNLTVIIPPESVIILDSKGVTIED-------HTLGPYNEGSGINITCVAIGGRPQPR 211
            ::.|::|:.....:| .:::..|:..|:|.:|       ...|....||    ||..:     ..
  Fly   295 RATTKSSRKEQDPVI-EQTLECLEKSGLTKKDLKAIPVIQVAGSKGRGS----TCAIV-----ES 349

  Fly   212 VTWLHGNTVYKNASVGQP---LSERRV---GNTLSLARLERRNLHMQLTCRAENNNLTTPIISSV 270
            :...||   .|...:..|   |:..|:   |..||  .::...|..::.....|.. .||..:.:
  Fly   350 ILRCHG---VKTGVLSSPHLFLTSERIRIDGEPLS--DVQFTELFWKINTDLANMQ-PTPSYNKI 408

  Fly   271 VLDMNLRPL------IVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKGSTPMKNT------ 323
            :..|.....      :..|:..|...|...:.......||.    |...|:.|:.:.|:      
  Fly   409 MTVMAFHAFHQAGVEVAILEVGNAGASDATNIASHAQTIGI----TTLGWEQSSNLGNSLRDIAW 469

  Fly   324 --HEIATPDGNLTTSV-------------------LTFTPTIDD------RGKFLSCRAEQSMIP 361
              ..|..|:.|:.|:|                   |...||.:|      ..|.|..:|..||  
  Fly   470 AKASIMKPEANIYTNVTQTECCEVLAQKAKQIGAQLRRVPTFNDYVEGDMNNKLLMNKANYSM-- 532

  Fly   362 ESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNP 426
                                     .||.:|...:...|   :|.:...|.|...||..:||...
  Fly   533 -------------------------RLNGSLAVQLAYDF---LKRHKPEYVVGLEHNSTLLTPGA 569

  Fly   427 AEGIAVSNQ------------SLVLQNAS------RARSGIYTCVGSNREGD-------GESNP- 465
            :.||.:..|            ::.|.:|.      ..|...||...:||:..       .|.|. 
  Fly   570 SRGIEIFEQPGHFDFMRHDMFNVYLDSADTFESMMACRDWFYTRTRANRQPKILLFNKVNEFNAK 634

  Fly   466 -----VQLDIRFAPVC---RPRQRLSYSSGRHETVKVACEIDANPAEATYVW------------- 509
                 ::.::||...|   .|    :|..|         ||.|.......||             
  Fly   635 DLLTIIRSNLRFEEACFVPNP----NYFEG---------EILAEEDGKAMVWHGMEELQRAKRNA 686

  Fly   510 -KFNATQGETVDIPASQVAVDRGRSIAHYTPMTENDYGTLLCWATNEI 556
             .:.|...|......||:::    ||..:.....|.||.......||:
  Fly   687 GNWRALCEENGKRDNSQLSI----SINAFFEYLTNKYGKQKYGMKNEL 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 Ig 55..166 CDD:299845 2/11 (18%)
IG_like 60..166 CDD:214653 2/11 (18%)
Ig 182..266 CDD:299845 19/96 (20%)
Ig 296..373 CDD:299845 20/109 (18%)
IG_like 389..464 CDD:214653 21/99 (21%)
IGc2 394..459 CDD:197706 18/82 (22%)
Ig_3 490..554 CDD:290638 14/77 (18%)
CG31773NP_722953.1 folC 309..745 CDD:273659 92/489 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3515
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.