DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and Nectin3

DIOPT Version :10

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:XP_038944117.1 Gene:Nectin3 / 288124 RGDID:1309516 Length:584 Species:Rattus norvegicus


Alignment Length:479 Identity:93/479 - (19%)
Similarity:179/479 - (37%) Gaps:108/479 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GTHWSDETYRERLSFHVEGRAGTLTIKSTTEDDTGEYR--------CRVDFQKSPTRNSKVNLTV 166
            |.|:|:...:.....:...||...|||..|...:...:        ||     ||...|.     
  Rat    32 GGHFSETNSKRNKRENKITRANMRTIKEKTRPHSKPSQWEKSMASCCR-----SPGAESG----- 86

  Fly   167 IIPPESVIILDSKGVTIEDHTLGPYNEGSGINITCVAIGGRPQPRVTW--LHGNTVYKNA----- 224
              .|.::    :..:.:|.|....:  |..:::.|:........:::|  :||.:....|     
  Rat    87 --QPGAL----AGSIIVEPHVTAVW--GKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQ 143

  Fly   225 ---SVGQPLSERRVGNTLSL--ARLERRNLHM----QLTCRAENNNLTTPI---ISSVVLDMNLR 277
               ||......|.:....||  |.:...|:..    :..|:|    :|.|:   .||..:.:.:.
  Rat   144 YGFSVQGEYQGRILFKNYSLNDATITLHNIGFSDSGKYICKA----VTFPLGNAQSSTTVTVLVE 204

  Fly   278 PLIVKLQGENRALSAGN-SYQLSCVVIGARPAPTITWWKGSTPMKNTHEIATPDGNLTTSVLT-- 339
            |.:..::|.:..:..|| :....|:....:|...|.|......|::|   .|...|.|.::::  
  Rat   205 PTVSLMKGPDSLIDGGNETVAAVCIAATGKPVARIDWEGDLGEMEST---ITSFPNETATIISQY 266

  Fly   340 -FTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVFFECN 403
             ..||...||:.::|..:...: |..:...:.|||.:.|.||: .|.:......|:|:::  :||
  Rat   267 KLFPTRFARGRRITCVVKHPAL-EKDIRYSFILDIQYAPEVSV-TGYDGNWFVGRKGVNL--KCN 327

  Fly   404 IKSNPWIYEVSWRHNGKILTNNPAEGIAVSNQSL-VLQNASRARSGIYTCVGSNREGDGESNPVQ 467
            ..:||..::..|..    |.....:|:..|:.:| .:...:...||:|.|..:|..|.       
  Rat   328 ADANPPPFKSVWSR----LDGEWPDGLLASDNTLHFVHPLTFNYSGVYVCKVTNSLGQ------- 381

  Fly   468 LDIRFAPVCRPRQRLSYSSGRHETVKVACEIDANPAEATYVWKFN-------ATQGETVDIPASQ 525
                     |..|::.|.|....|..:         :.|..|:.:       ||:.:.:..|.|.
  Rat   382 ---------RSDQKVIYISDPPTTTTL---------QPTVQWRSSTADVQDLATEHKKLPFPLST 428

  Fly   526 VAVDRGRSIAHYTPMTENDYGTLL 549
            :|.           :.::..||::
  Rat   429 LAT-----------LKDDTIGTII 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653 14/63 (22%)
Ig strand B 69..72 CDD:409353
Ig strand C 85..89 CDD:409353
Ig strand E 131..135 CDD:409353 0/3 (0%)
Ig strand F 145..150 CDD:409353 1/12 (8%)
Ig 189..273 CDD:472250 19/102 (19%)
Ig strand B 197..201 CDD:409353 0/3 (0%)
Ig strand C 211..215 CDD:409353 1/5 (20%)
Ig strand E 237..241 CDD:409353 0/3 (0%)
Ig strand F 252..257 CDD:409353 1/4 (25%)
Ig strand G 267..270 CDD:409353 1/2 (50%)
Ig 290..373 CDD:472250 18/86 (21%)
Ig strand B 296..300 CDD:409353 0/3 (0%)
Ig strand C 310..314 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 366..369 CDD:409353 0/2 (0%)
Ig_3 377..456 CDD:464046 19/79 (24%)
Nectin3XP_038944117.1 IgV_1_Nectin-3_like 93..202 CDD:409470 21/114 (18%)
FR1 93..116 CDD:409470 4/24 (17%)
Ig strand A 93..97 CDD:409470 0/3 (0%)
Ig strand A' 99..103 CDD:409470 1/3 (33%)
Ig strand B 108..116 CDD:409470 1/7 (14%)
CDR1 117..121 CDD:409470 0/3 (0%)
FR2 122..128 CDD:409470 1/5 (20%)
Ig strand C 123..128 CDD:409470 1/4 (25%)
CDR2 129..148 CDD:409470 3/18 (17%)
Ig strand C' 138..143 CDD:409470 1/4 (25%)
Ig strand C' 145..149 CDD:409470 1/3 (33%)
FR3 149..187 CDD:409470 7/41 (17%)
Ig strand D 156..160 CDD:409470 0/3 (0%)
Ig strand E 165..172 CDD:409470 1/6 (17%)
Ig strand F 179..187 CDD:409470 2/11 (18%)
CDR3 188..191 CDD:409470 1/2 (50%)
Ig strand G 191..201 CDD:409470 2/9 (22%)
FR4 192..202 CDD:409470 2/9 (22%)
IgC1_2_Nectin-3-4_like 205..300 CDD:409501 20/98 (20%)
Ig strand A 205..211 CDD:409501 1/5 (20%)
Ig strand B 224..231 CDD:409501 1/6 (17%)
Ig strand C 236..242 CDD:409501 1/5 (20%)
Ig strand C' 244..246 CDD:409501 0/1 (0%)
Ig strand D 248..255 CDD:409501 3/9 (33%)
Ig strand E 260..268 CDD:409501 0/7 (0%)
Ig strand F 278..285 CDD:409501 1/6 (17%)
Ig strand G 291..297 CDD:409501 0/5 (0%)
Ig 304..390 CDD:472250 23/108 (21%)
Ig strand B 322..326 CDD:409353 0/5 (0%)
Ig strand C 336..340 CDD:409353 0/3 (0%)
Ig strand E 355..360 CDD:409353 1/4 (25%)
Ig strand F 370..375 CDD:409353 2/4 (50%)
Ig strand G 385..388 CDD:409353 1/2 (50%)
TM_EGFR-like 438..467 CDD:213052 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.