DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and ceacam8l

DIOPT Version :10

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:XP_031761715.1 Gene:ceacam8l / 101730286 XenbaseID:XB-GENE-22169429 Length:407 Species:Xenopus tropicalis


Alignment Length:304 Identity:77/304 - (25%)
Similarity:117/304 - (38%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 TWWKGSTPMKNTHEIAT--------------------PDGNLTTSVLTFTPTIDDRGKF--LSCR 354
            :|:|||:...|....:.                    |:|:|..|.|  .||  |:|.:  |...
 Frog    59 SWYKGSSADTNNQIFSVIPSANSVTKGPQYFPRANWLPNGSLQISGL--VPT--DQGNYTVLMYT 119

  Fly   355 AEQSMIPESGMEDGWKLDIYHIPVVSLELGTNSLNSTLREGIDVFFECNIKSNPWIYEVSWRHNG 419
            |      ||..:|...|.:|. ||.|..:.|:  |...:|...|...|:..:   ..::.|..||
 Frog   120 A------ESTTQDTVSLPV
YE-PVSSSGISTD--NKEPQENQPVTLTCSANN---AEQILWSKNG 172

  Fly   420 KILTNNPAEGIAVSNQSLVLQNASRARSGIYTCVGSNREGDGESNPVQLDIRFAPV-CRPRQRLS 483
            ..|.  |...::..|::|.....||:.:|.|.|..||......|:|..|.:.:.|. .:.:..|.
 Frog   173 VPLP--PGLTLSADNRTLTFPRISRSDTGQYRCEASNAVSKIISDPYTLTVNYGPENLKIKGTLQ 235

  Fly   484 YSSGRHETVKVACEIDANPAEATYVWKFNAT--QGETVDIPASQVAVDRGRSIAHYTPMTENDYG 546
            .:||  .:..:.|..|:.|| .||.||||.|  :.:|..:...|.           ||.:..:| 
 Frog   236 VTSG--YSTSLECSADSVPA-PTYQWKFNGTNLESQTNTLYIQQA-----------TPESAGNY- 285

  Fly   547 TLLCWATNEIGDQS-EPCVYTIF--------PAGEPDPLLNCTV 581
              .|..||.:...| |..||...        |.| |.|:....:
 Frog   286 --TCIGTNSVTKLSRETSVYVSVNDYNPSDNPIG-PGPIAGIAI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653
Ig strand B 69..72 CDD:409353
Ig strand C 85..89 CDD:409353
Ig strand E 131..135 CDD:409353
Ig strand F 145..150 CDD:409353
Ig 189..273 CDD:472250
Ig strand B 197..201 CDD:409353
Ig strand C 211..215 CDD:409353
Ig strand E 237..241 CDD:409353
Ig strand F 252..257 CDD:409353
Ig strand G 267..270 CDD:409353
Ig 290..373 CDD:472250 20/82 (24%)
Ig strand B 296..300 CDD:409353
Ig strand C 310..314 CDD:409353 0/1 (0%)
Ig strand F 350..355 CDD:409353 1/6 (17%)
Ig strand G 366..369 CDD:409353 1/2 (50%)
Ig_3 377..456 CDD:464046 20/78 (26%)
ceacam8lXP_031761715.1 Ig 29..132 CDD:472250 20/82 (24%)
Ig strand B 44..48 CDD:409353
Ig strand C 57..61 CDD:409353 0/1 (0%)
Ig strand E 98..102 CDD:409353 2/3 (67%)
Ig strand F 112..117 CDD:409353 0/4 (0%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig 139..222 CDD:472250 22/89 (25%)
Ig strand B 154..158 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 1/3 (33%)
Ig strand E 186..190 CDD:409353 1/3 (33%)
Ig strand F 200..205 CDD:409353 2/4 (50%)
Ig strand G 215..218 CDD:409353 1/2 (50%)
Ig_3 236..291 CDD:464046 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.