DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and si:ch211-141e20.2

DIOPT Version :10

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:XP_068079685.1 Gene:si:ch211-141e20.2 / 100150732 ZFINID:ZDB-GENE-070912-75 Length:504 Species:Danio rerio


Alignment Length:321 Identity:68/321 - (21%)
Similarity:121/321 - (37%) Gaps:72/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 PIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKG----STPMKNTHE 325
            ||.:.:...:..|| .|.::||...:........||....||||..:||..|    |...:..| 
Zfish   142 PIAT
YIKASVFARP-AVTVKGEEPVIGCLEVILASCFASNARPAAEVTWRLGELEKSLKTRTNH- 204

  Fly   326 IATPDGNLTTSVLTF---TPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIP--VVSLELGT 385
              |.:.|.|.:|:::   .|......|.:.|..:.:.:.|. :...:.:||::.|  |:.:...:
Zfish   205 --TVNANETITVVSYLLGVPFKHLHKKNIQCVVKHNSLTEH-LVLNYTI
DIHYPPESVIIIPDSS 266

  Fly   386 NSLNSTLREGIDVFFECNIKSN--PWIYEVSWRHNGKILTNNPAEGIAVSNQSLVLQNASRARSG 448
            ..:|.         |.|.:.||  |.:...:|....|  ::...||     ..|.:.|.:...:|
Zfish   267 TDVNE---------FRCIVDSNPQPTLKGYNWTRVNK--SSQFFEG-----NRLPVPNMTPELNG 315

  Fly   449 IYTCVGSNR-------------EGDGESNPVQLDIRFAPVCRPRQRLSYSSGRHETVKVACE--- 497
            :|.|..||:             .|||        .::..:.....|:.:|...|:.:   |.   
Zfish   316 LYICNASNKYGSALGSLYVNVHAGDG--------FQYHRLTLKETRIQHSQETHQLI---CHLFR 369

  Fly   498 --IDANPAEATY-VWKFNATQGE-----TVDIPASQVAVDRGRSIAH--YTPMTENDYGTL 548
              :..||.:..: |......:|:     .:::.|   .|.|||...|  |.|.::...|.|
Zfish   370 QMLHRNPTQRVHQVRALQKKEGQLRFNYALNLKA---FVARGRKWIHLRYAPASDPTDGAL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653
Ig strand B 69..72 CDD:409353
Ig strand C 85..89 CDD:409353
Ig strand E 131..135 CDD:409353
Ig strand F 145..150 CDD:409353
Ig 189..273 CDD:472250 2/7 (29%)
Ig strand B 197..201 CDD:409353
Ig strand C 211..215 CDD:409353
Ig strand E 237..241 CDD:409353
Ig strand F 252..257 CDD:409353
Ig strand G 267..270 CDD:409353 0/2 (0%)
Ig 290..373 CDD:472250 19/89 (21%)
Ig strand B 296..300 CDD:409353 0/3 (0%)
Ig strand C 310..314 CDD:409353 1/3 (33%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 366..369 CDD:409353 0/2 (0%)
Ig_3 377..456 CDD:464046 17/82 (21%)
si:ch211-141e20.2XP_068079685.1 Ig 46..145 CDD:472250 2/2 (100%)
Ig strand B 55..59 CDD:409353
Ig strand C 70..74 CDD:409353
Ig strand E 116..120 CDD:409353
Ig strand F 130..135 CDD:409353
Ig 163..250 CDD:472250 19/90 (21%)
Ig strand B 172..176 CDD:409353 0/3 (0%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 216..220 CDD:409353 0/3 (0%)
Ig strand F 230..235 CDD:409353 1/4 (25%)
Ig strand G 245..248 CDD:409353 0/2 (0%)
Ig 271..336 CDD:472250 16/80 (20%)
Ig strand B 271..274 CDD:409353 1/11 (9%)
Ig strand C 283..291 CDD:409353 1/7 (14%)
Ig strand E 302..306 CDD:409353 1/3 (33%)
Ig strand F 316..321 CDD:409353 2/4 (50%)
Ig strand G 329..332 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.