DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment side-VIII and si:ch211-222f23.6

DIOPT Version :10

Sequence 1:NP_001097382.2 Gene:side-VIII / 37310 FlyBaseID:FBgn0086604 Length:1201 Species:Drosophila melanogaster
Sequence 2:NP_001120876.1 Gene:si:ch211-222f23.6 / 100141493 ZFINID:ZDB-GENE-070912-208 Length:367 Species:Danio rerio


Alignment Length:388 Identity:85/388 - (21%)
Similarity:140/388 - (36%) Gaps:97/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GRAGTLTIKST-TEDDTGEYRCRVDFQKSPTRNSKVNLTVIIPPESVIILDSKGVT----IEDHT 187
            |...||....| |:::|.    ||.:||..:.|.:        ||:..|:...|.|    ::|| 
Zfish    37 GEDATLFCDLTATQENTS----RVVWQKQTSENHQ--------PETFFIIHKDGRTEHRDLQDH- 88

  Fly   188 LGPYNEGSGINITCVAIGGRPQPRVTWLHGNTVYKNASVGQPLSERRVGNTLSLARLERRNLHMQ 252
                                    |.:: ||.:..|.|: |.:..:.|.:.:             
Zfish    89 ------------------------VRFV-GNLMENNGSI-QLMGLKLVDDGI------------- 114

  Fly   253 LTCRAENNNLTTPIISSVVLDMNLRPLIVKLQGENRALSAGNSYQLSCVVIGARPAPTITWWKGS 317
            .||....|......:.||.:   |.|.:..:.|......|.:....||:..|||||..:.|..|:
Zfish   115 YTCIFTINEQQAQKVISVTV---LVPPVGSVMGSTHVSGAFSVDLASCMASGARPAARVFWRLGA 176

  Fly   318 -TPMKNTHEIAT--PDGNLTT-SVLTFTPTIDDRGKFLSCRAEQSMIPESGMEDGWKLDIYHIP- 377
             ....|||..:|  .||..|. |.:...|:.....|.:.|..:.....|. :|..:::::::.| 
Zfish   177 LNTSLNTHTSSTEHSDGTFTVQSHIYGVPSKHLHQKKIQCVVQHITFTED-LELEYQINVHYPPD 240

  Fly   378 --VVSLELGTNSLNSTLREGIDVFFECNIKSNPWIYEVSWRHNGKILTNNPAEGIA--VSNQSLV 438
              ::|.:...|...:.       .:.|.:..||....: |:.      .|.:||.|  .....|.
Zfish   241 LVIISPDDPNNPAEAE-------EYHCEVDCNPTPTYI-WKR------MNESEGRAPRYEGNKLF 291

  Fly   439 LQNASRARSGIYTCVGSNREGDGESNPVQ-------------LDIRFAPVCRPRQRLSYSSGR 488
            |..:|...:|:|.|..||:.|....:.:.             |.:.|..|......|.|||||
Zfish   292 LPKSSVDLNGVYICTASNQYGSASGSVLHVNLTGCSVFRWCILGVIFIVVLCSSVVLKYSSGR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
side-VIIINP_001097382.2 IG_like 60..166 CDD:214653 11/38 (29%)
Ig strand B 69..72 CDD:409353
Ig strand C 85..89 CDD:409353
Ig strand E 131..135 CDD:409353 2/3 (67%)
Ig strand F 145..150 CDD:409353 0/4 (0%)
Ig 189..273 CDD:472250 12/83 (14%)
Ig strand B 197..201 CDD:409353 0/3 (0%)
Ig strand C 211..215 CDD:409353 1/3 (33%)
Ig strand E 237..241 CDD:409353 0/3 (0%)
Ig strand F 252..257 CDD:409353 2/4 (50%)
Ig strand G 267..270 CDD:409353 0/2 (0%)
Ig 290..373 CDD:472250 23/86 (27%)
Ig strand B 296..300 CDD:409353 0/3 (0%)
Ig strand C 310..314 CDD:409353 0/3 (0%)
Ig strand F 350..355 CDD:409353 1/4 (25%)
Ig strand G 366..369 CDD:409353 1/2 (50%)
Ig_3 377..456 CDD:464046 17/83 (20%)
si:ch211-222f23.6NP_001120876.1 V-set 34..135 CDD:462230 30/152 (20%)
Ig 154..226 CDD:472250 20/71 (28%)
Ig strand B 155..159 CDD:409353 0/3 (0%)
Ig strand C 169..173 CDD:409353 0/3 (0%)
Ig strand E 199..203 CDD:409353 1/3 (33%)
Ig strand F 213..218 CDD:409353 1/4 (25%)
Ig 252..317 CDD:472250 17/78 (22%)
Ig strand B 256..260 CDD:409353 0/10 (0%)
Ig strand C 269..273 CDD:409353 0/4 (0%)
Ig strand E 288..292 CDD:409353 1/3 (33%)
Ig strand F 302..307 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.