DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss36

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:273 Identity:92/273 - (33%)
Similarity:130/273 - (47%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TPTPGD------------GRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCFE- 71
            :||.|:            .|||||..|....:|:|||:...|.|||||::|....||:|||||. 
Mouse    28 SPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFVT 92

  Fly    72 ----DPWSSADYTVRVGSSEHE-SGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
                :|.......:.|.|.:.. .|.|:.|:..::...:|:......|||||.|.........::
Mouse    93 NGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVR 157

  Fly   132 PVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYS------ 190
            ||.|...:......|....:||| ..:|:.   .:.:...|:.|::.|:....|:..||      
Mouse   158 PVCLPRASHLFAHGTACWATGWG-DVQEAV---PLPLPWVLQEVELRLLGEAACQCLYSRPGPFN 218

  Fly   191 ---QVLPITRRMICAARPG--RDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYT 250
               |:||   .|:||..|.  ||:||||||||||  ..:.|...|.||.|:|.||...|.|||:|
Mouse   219 LTFQLLP---GMLCAGYPAGRRDTCQGDSGGPLV--CEDGGRWFLAGITSFGFGCGRRNRPGVFT 278

  Fly   251 NVAAFRSWIDEQL 263
            .||.:.|||.|.:
Mouse   279 AVAPYESWIREHV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/248 (35%)
Tryp_SPc 28..262 CDD:238113 87/250 (35%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 87/250 (35%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.