DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:273 Identity:93/273 - (34%)
Similarity:130/273 - (47%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF 70
            |..:|.|.|    |.|...|.:||||........|||||:.....|.|||::|....||:||||:
Mouse     6 FFTFLGAAV----ALPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCY 66

  Fly    71 EDPWSSADYTVRVGSSEH-----ESGGHVLSLRRVIAHGDYNPQSHDNDLALL------ILNGQL 124
            :     ....||:|  ||     |.|...:...::|.|.|||..:.|||:.|:      |||.|:
Mouse    67 K-----RRLQVRLG--EHNIDVLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQV 124

  Fly   125 NFTEHLQPVPLAALADPPTADTRLQ--VSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRR 187
            :...    :|.:.      |.|..|  |||||   ...::.|:  ....|:.::..::.::.|::
Mouse   125 STVS----LPRSC------ASTNAQCLVSGWG---NTVSIGGK--YPALLQCLEAPVLSASSCKK 174

  Fly   188 AYSQVLPITRRMICAA--RPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYT 250
            :|..  .||..|.|..  ..|:|||.||||||:|      ....:.||||||..||....|||||
Mouse   175 SYPG--QITSNMFCLGFLEGGKDSCDGDSGGPVV------CNGEIQGIVSWGSVCAMRGKPGVYT 231

  Fly   251 NVAAFRSWIDEQL 263
            .|..:.|||.|.:
Mouse   232 KVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 83/246 (34%)
Tryp_SPc 28..262 CDD:238113 85/248 (34%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 83/246 (34%)
Tryp_SPc 24..243 CDD:238113 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.