DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and TPSAB1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:272 Identity:95/272 - (34%)
Similarity:130/272 - (47%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVAYAGATPTPGDG----RIVGGEVATIQEFPYQVSVQLQG---RHICGGAIIGIDTVLTAA 67
            |..|.:.|.|.|.||..    .||||:.|...::|:|||:::.|   .|.|||::|....|||||
Human     9 LPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAA 73

  Fly    68 HCF-EDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQ 131
            ||. .|....|...|::..........:|.:.|:|.|..:.......|:|||.|...:|.:.|:.
Human    74 HCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVH 138

  Fly   132 PVPLAALADPPTADT-----RLQVSGWGFQAEESAVSGEVGVSP--QLRFVDVDLVESNQCRRAY 189
            .|.|     ||.::|     ...|:|||      .|..:..:.|  .|:.|.|.::|::.|...|
Human   139 TVTL-----PPASETFPPGMPCWVTGWG------DVDNDERLPPPFPLKQVKVPIMENHICDAKY 192

  Fly   190 -------SQVLPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPG 247
                   ..|..:...|:||....|||||||||||||  ....|.....|:||||.|||.||.||
Human   193 HLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLV--CKVNGTWLQAGVVSWGEGCAQPNRPG 255

  Fly   248 VYTNVAAFRSWI 259
            :||.|..:..||
Human   256 IYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/249 (35%)
Tryp_SPc 28..262 CDD:238113 88/250 (35%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 88/250 (35%)
Tryp_SPc 31..267 CDD:214473 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.