DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Prss55

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:254 Identity:92/254 - (36%)
Similarity:131/254 - (51%) Gaps:24/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF-EDPWSSADYTVRVGSSEHES 90
            ||:.|:.|.:.|||:|||:|....|.|||:|:....:||.|||| ....|..|..||||:::..:
Mouse    60 RIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQELSPTDLRVRVGTNDLTT 124

  Fly    91 GGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWGF 155
            ....|.:..:|.|..:...:.|||:|||:|...|.|.|...|:.|.....||:.. ...|:|||.
Mouse   125 SPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWH-ECWVAGWGV 188

  Fly   156 QAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP-ITRRMICAA--RPGRDSCQGDSGGP 217
            .......|    :|..|..|.:.::|..:|    .|:.| :|..|:||:  ....|:||||||||
Mouse   189 TNSTDKES----MSTDLMKVPMRIIEWEEC----LQMFPSLTTNMLCASYGNESYDACQGDSGGP 245

  Fly   218 LVGYAAEEGPARLY--GIVSWGLGCANPNFPGVYTNVAAFRSWID-------EQLDARG 267
            ||  ...:..:|.|  ||:|||..|....|||:||.:|.:..||:       :.||.||
Mouse   246 LV--CTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQTEGKPLDFRG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 86/237 (36%)
Tryp_SPc 28..262 CDD:238113 87/246 (35%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 86/237 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.