DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk12

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:259 Identity:84/259 - (32%)
Similarity:118/259 - (45%) Gaps:65/259 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGEVATIQEFPYQVSVQLQGRHI-CGGAIIGIDTVLTAAHCFEDPWSSADYTVRVGSSEHES 90
            :|..|........|:||.: ..|::: |||.::....|||||||.:      .|.||:|  ||  
Mouse    21 KIYNGVECVKNSQPWQVGL-FHGKYLRCGGVLVDRKWVLTAAHCRD------KYVVRLG--EH-- 74

  Fly    91 GGHVLSLRRV------------IAHGDYNP--QSHDNDLALLILNGQLNFTEHLQPVPLAALADP 141
                 ||.::            |.|..|..  |:|::||.||.||..::.|..::||.|.:..  
Mouse    75 -----SLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHLTRAVRPVALPSSC-- 132

  Fly   142 PTADTRLQVSGWGFQAEESAVSGEVGVSP------QLRFVDVDLVESNQCRRAYSQVLP--ITRR 198
            .|......|||||...:           |      :|:.:::..|.:..||    .|.|  :|..
Mouse   133 VTTGAMCHVSGWGTTNK-----------PWDPFPDRLQCLNLSTVSNETCR----AVFPGRVTEN 182

  Fly   199 MICA-ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LG-CANPNFPGVYTNVAAFRSWI 259
            |:|| ...|:|:||||||||||....      |.|:|||| :| |.....|||||.|..:..||
Mouse   183 MLCAGGEAGKDACQGDSGGPLVCGGV------LQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 82/257 (32%)
Tryp_SPc 28..262 CDD:238113 84/258 (33%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 82/257 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.