DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and CG34458

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:243 Identity:92/243 - (37%)
Similarity:136/243 - (55%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF--EDPWSSADYTVRVGSSE 87
            :.||:||:.|...:||:|||:||.|||.|||::|....::|||||.  ::|   ......||:::
  Fly    29 ESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQNP---GQMKAIVGTND 90

  Fly    88 HESG-GHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVS 151
            ..:| |...::.:.|.|..|||||.|.|::|:.|:..:.....:|.:.||.......|||...:|
  Fly    91 LSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAADTMAMIS 155

  Fly   152 GWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLP-ITRRMICAARPGR--DSCQGD 213
            |:|      |::..:.:..:|:|..|.|...:.|.   ||.:| :|.||:||..|..  .|||||
  Fly   156 GFG------AINQNLQLPNRLKFAQVQLWSRDYCN---SQNIPGLTDRMVCAGHPSGQVSSCQGD 211

  Fly   214 SGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261
            |||||    ..:|  :|:|:||||.||.....|.:||.|.|.||||.:
  Fly   212 SGGPL----TVDG--KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIKQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 90/237 (38%)
Tryp_SPc 28..262 CDD:238113 91/240 (38%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 90/237 (38%)
Tryp_SPc 32..254 CDD:238113 91/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.