DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and Klk4

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:126/265 - (47%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKFLWWLMALV-AYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAA 67
            |.:.|:|..|: ...||:.:....||:.|:..:....|:|.::..:....|.|.::....||:||
Mouse     7 TPWGWFLGCLILEVTGASASSVSSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAA 71

  Fly    68 HCFEDPWSSADYTVRVG----SSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFTE 128
            ||.::     .|.|.:|    ....|.|..:|.....|.|.::|..|..|||.|:.||..:..:.
Mouse    72 HCLQE-----SYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPSFANDLMLIKLNESVIESN 131

  Fly   129 HLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQ-LRFVDVDLVESNQCRRAYSQV 192
            .::.:|:|... |...||.| ||||| |.:.       |..|. |:.|::.:.....||..|..|
Mouse   132 TIRSIPVATQC-PTPGDTCL-VSGWG-QLKN-------GKLPSLLQCVNLSVASEETCRLLYDPV 186

  Fly   193 LPITRRMICA--ARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLG-CANPNFPGVYTNVAA 254
            ..::  |.||  .:..:|||.||||||:|...:      |.|:||.|.| |..|..|.||||:..
Mouse   187 YHLS--MFCAGGGQDQKDSCNGDSGGPIVCNRS------LQGLVSMGQGKCGQPGIPSVYTNLCK 243

  Fly   255 FRSWI 259
            |.:||
Mouse   244 FTNWI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 76/239 (32%)
Tryp_SPc 28..262 CDD:238113 77/240 (32%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.