DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11192 and AZU1

DIOPT Version :9

Sequence 1:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:272 Identity:98/272 - (36%)
Similarity:135/272 - (49%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LMALVA------YAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAH 68
            ::||:|      .||::|...   ||||..|..::||:..|:|.||||.||||:|....|:|||.
Human     6 VLALLAGLLASSRAGSSPLLD---IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAAS 67

  Fly    69 CF--EDPWSSADYTVRVGSSE----HESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNFT 127
            ||  ::|..|   ||.:|:.:    ........|:..:..:| |:||.:.|||.||.|:.:.|.|
Human    68 CFQSQNPGVS---TVVLGAYDLRRRERQSRQTFSISSMSENG-YDPQQNLNDLMLLQLDREANLT 128

  Fly   128 EHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQV 192
            ..:..:||........|.||.||:|||.|..    .|.:...|  |||:|.:...:|||......
Human   129 SSVTILPLPLQNATVEAGTRCQVAGWGSQRS----GGRLSRFP--RFVNVTVTPEDQCRPNNVCT 187

  Fly   193 LPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLG-CA-NPNFPGVYTNVAAF 255
            ..:|||        ...|.||.|.|||.    ||.|  :|:.|:.|| |. .|:|   :|.||.|
Human   188 GVLTRR--------GGICNGDGGTPLVC----EGLA--HGVASFSLGPCGRGPDF---FTRVALF 235

  Fly   256 RSWIDEQLDARG 267
            |.|||..|:..|
Human   236 RDWIDGVLNNPG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 87/239 (36%)
Tryp_SPc 28..262 CDD:238113 90/241 (37%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 88/239 (37%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 14/23 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.